PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00711.1_g00013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 362aa    MW: 39684.7 Da    PI: 7.9059
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00711.1_g00013.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.61.2e-53181451128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeelvv+yLk+k+++ +l++ ++i++vd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkat
  Rsa1.0_00711.1_g00013.1  18 LPPGFRFHPTDEELVVHYLKRKAASAPLPV-SIIADVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKAT 102
                              79****************************.89***************999999******************************** PP

                      NAM  87 gkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+dk+vl++ ++++vg+kk Lvfy+g+ pkg+k+dW+mheyrl
  Rsa1.0_00711.1_g00013.1 103 GTDKPVLASdGNQKVGVKKALVFYSGKPPKGVKSDWIMHEYRL 145
                              *******9967788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-6514179IPR003441NAC domain
PROSITE profilePS5100562.32118179IPR003441NAC domain
PfamPF023657.1E-2819145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MESTDSSGGP PPPPQPNLPP GFRFHPTDEE LVVHYLKRKA ASAPLPVSII ADVDLYKFDP  60
WELPAKASFG EQEWYFFSPR DRKYPNGARP NRAATSGYWK ATGTDKPVLA SDGNQKVGVK  120
KALVFYSGKP PKGVKSDWIM HEYRLIDNKP NNRPPGCDYG NKKNSLRLDD WVLCRIYKKN  180
NAGRHVDNEK DHDMIDYIFR KIPSGLNHNV SRSMNFFPGR FSGGYGMFSD GDPGLYDGSG  240
LMCSNGAADA VNLNVCNGNP IAEVVGNGLN PVSSSGTMMM MANLKRALPM PYWPVAEEEH  300
DVSPSKRFHG VGGVGGGGDC SNMSSSMVEE PPPLMQQQGG ALGDGLFRTT SYQLPGLNWY  360
ST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-731218411170NO APICAL MERISTEM PROTEIN
1ut4_B2e-731218411170NO APICAL MERISTEM PROTEIN
1ut7_A2e-731218411170NO APICAL MERISTEM PROTEIN
1ut7_B2e-731218411170NO APICAL MERISTEM PROTEIN
4dul_A2e-731218411170NAC domain-containing protein 19
4dul_B2e-731218411170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9747610.0KF974761.1 Brassica napus NAC transcription factor 56-1 (NAC56-1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001302865.10.0NAC transcription factor 56-like
SwissprotQ9LD440.0NAC56_ARATH; NAC transcription factor 56
TrEMBLA0A0C4MXF00.0A0A0C4MXF0_BRANA; NAC56-1.1 protein
STRINGBra021114.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.10.0NAC domain containing protein 2